PDB entry 5adu

View 5adu on RCSB PDB site
Description: The Mechanism of Hydrogen Activation by NiFe-hydrogenases
Class: oxidoreductase
Keywords: oxidoreductase, nife-hydrogenase, hydrogen lysis,
Deposited on 2015-08-24, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • engineered mutation (117)
      • engineered mutation (573)
    Domains in SCOPe 2.07: d5adul_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACD8 (Start-581)
      • engineered mutation (117)
      • engineered mutation (573)
    Domains in SCOPe 2.07: d5adum_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5adus_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5adut_
  • Heterogens: FCO, NI, MG, SO4, SF4, F3S, SF3, LMT, CL, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5aduL (L:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchnhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfnpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aduL (L:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchnhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfnpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5aduM (M:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchnhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfnpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aduM (M:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchnhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfnpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5aduS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aduS (S:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5aduT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aduT (T:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrv