PDB entry 5adi

View 5adi on RCSB PDB site
Description: Structure of human nNOS R354A G357D mutant heme domain in complex with 7-(((5-((Methylamino)methyl)pyridin-3-yl)oxy)methyl)quinolin-2- amine
Class: oxidoreductase
Keywords: oxidoreductase, nitric oxide synthase
Deposited on 2015-08-20, released 2015-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-420)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d5adia_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (Start-420)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d5adib_
  • Heterogens: HEM, H4B, TUE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5adiA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5adiA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpdvatkdqlfplakefidq
    yyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwskl
    qvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryag
    ykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlev
    pirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsry
    nileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmen
    eyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5adiB (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5adiB (B:)
    rflkvknwetevvltdtlhlkstletgcteyicmgsimhpatkdqlfplakefidqyyss
    ikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvfd
    ardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqp
    dgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpirh
    pkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynile
    evakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrc
    rggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk