PDB entry 5acn

View 5acn on RCSB PDB site
Description: structure of activated aconitase. formation of the (4fe-4s) cluster in the crystal
Class: lyase(carbon-oxygen)
Keywords: lyase(carbon-oxygen)
Deposited on 1990-01-16, released 1990-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aconitase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16276 (1-753)
      • conflict (646)
    Domains in SCOPe 2.04: d5acna1, d5acna2
  • Heterogens: SO4, F3S, TRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5acnA (A:)
    erakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprhlggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk