PDB entry 5acb

View 5acb on RCSB PDB site
Description: Crystal Structure of the Human Cdk12-Cyclink Complex
Class: transferase
Keywords: transferase
Deposited on 2015-08-14, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5acba1, d5acba2
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5acbb1, d5acbb2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5acbc_
  • Chain 'D':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5acbd_
  • Heterogens: 5I1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5acbA (A:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5acbA (A:)
    tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
    rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
    vmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlsl
    qwepeiiavavmylagrlckfeiqewtsrrwweqfvqdvpvdvledichqildlysq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5acbB (B:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5acbB (B:)
    tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
    rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
    vmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlsl
    qwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys
    qgkqqmph
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5acbC (C:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5acbC (C:)
    esdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitairei
    kilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedh
    iksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnk
    vitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgsp
    cpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtl
    qsdflkdvelskmappdlphwqdch
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5acbD (D:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5acbD (D:)
    dwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireiki
    lrqlihrsvvnmkeivtdkqfkkdkgafylvfeymdhdlmgllesglvhfsedhiksfmk
    qlmegleychkknflhrdikcsnillnnsgqikladfglarlynsrpytnkvitlwyrpp
    elllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdvi
    klpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdve
    lskmappdlphwqdchelws