PDB entry 5abu

View 5abu on RCSB PDB site
Description: Complex of D. melanogaster eIF4E with the 4E-binding protein Mextli and cap analog
Class: translation
Keywords: translation, gene regulation, cap binding protein, 4e binding protein
Deposited on 2015-08-09, released 2015-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48598 (4-183)
      • expression tag (2-3)
    Domains in SCOPe 2.08: d5abua1, d5abua2
  • Chain 'B':
    Compound: 4e-binding protein mextli
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5abuA (A:)
gphmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdy
slfkknirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgav
inirgksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvks
iytl

    Sequence, based on observed residues (ATOM records): (download) 
    >5abuA (A:)
hmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdysl
fkknirpmwedaankqggrwvitlsktdldnlwldvllcligeafdhsdqicgavinirg
ksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkvksiytl

  • Chain 'B':
    No sequence available.