PDB entry 5aba

View 5aba on RCSB PDB site
Description: Structure of the p53 cancer mutant Y220C with bound small-molecule stabilizer PhiKan5149
Class: transcription
Keywords: transcription, cancer, tumor suppression, DNA binding, cancer therapy, small molecule stabilizers, molecular chaperone, halogen bonding
Deposited on 2015-08-04, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5abaa_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-End)
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5abab_
  • Heterogens: ZN, UL7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5abaA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5abaA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
    vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
    acpgrdrrteeenlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5abaB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5abaB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlr