PDB entry 5ab3

View 5ab3 on RCSB PDB site
Description: S.enterica HisA mutant D7N, D10G, dup13-15, Q24L, G102A
Class: isomerase
Keywords: isomerase, hisa, protein evolution, iad model, trpf
Deposited on 2015-07-31, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methyliden amino]imidazole-4-carboxamide isomerase
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot V7IJE3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • insertion (14)
      • insertion (14)
      • engineered mutation (26)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d5ab3a_
  • Chain 'B':
    Compound: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methyliden amino]imidazole-4-carboxamide isomerase
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot V7IJE3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • insertion (14)
      • insertion (14)
      • engineered mutation (26)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d5ab3b_
  • Chain 'C':
    Compound: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methyliden amino]imidazole-4-carboxamide isomerase
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot V7IJE3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • insertion (14)
      • insertion (14)
      • engineered mutation (26)
      • engineered mutation (104)
    Domains in SCOPe 2.07: d5ab3c_
  • Heterogens: 2ER, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ab3A (A:)
    miipalnliggtvvrvvrlhqgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdp
    akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwfe
    rfgaqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisrdg
    tlagsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvke
    aiqcwqnvkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ab3A (A:)
    miipalnliggtvvrvvrlhqgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdp
    akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwfe
    rfgaqalvlaldvridehgtkqvavsgvsleqlvetylpvglkhvlctdisrdgtlagsn
    vslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiqcwq
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ab3B (B:)
    miipalnliggtvvrvvrlhqgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdp
    akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwfe
    rfgaqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisrdg
    tlagsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvke
    aiqcwqnvkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ab3B (B:)
    miipalnliggtvvrvvrlgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdpak
    rqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwferf
    gaqalvlaldvridehgtkqvagvsleqlvetylpvglkhvlctdisrdgtlagsnvsly
    eevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiqcwqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ab3C (C:)
    miipalnliggtvvrvvrlhqgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdp
    akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwfe
    rfgaqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisrdg
    tlagsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvke
    aiqcwqnvkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ab3C (C:)
    miipalnliggtvvrvvrlhqgdyarlrdygndplprlqdyaaqgagvlhlvdltgakdp
    akrqipliktlvagvnvpvqvgggvrteedvaallkagvarvviastavkspdvvkgwfe
    rfgaqalvlaldvridehgtkqvavensgvsleqlvetylpvglkhvlctdisrdgtlag
    snvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiqc
    wqn