PDB entry 5a81

View 5a81 on RCSB PDB site
Description: Crystal structure of human ATAD2 bromodomain in complex with 8-(3R,4R) -3-(cyclohexylmethoxy)piperidin-4-yl-amino-3-methyl-1,2-dihydro-1,7- naphthyridin-2-one
Class: hydrolase
Keywords: hydrolase, inhibitor, atad2, bromodomain, epigenetics, ATPase family aaa domain-containing protein 2
Deposited on 2015-07-11, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase family AAA domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PL18 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5a81a1, d5a81a2
  • Heterogens: EDO, 78J, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a81A (A:)
    smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
    dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
    qlceeiqesr