PDB entry 5a7o

View 5a7o on RCSB PDB site
Description: Crystal structure of human JMJD2A in complex with compound 42
Class: oxidoreductase
Keywords: oxidoreductase, jmjd2a, kdm4a
Deposited on 2015-07-09, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75164
      • conflict (375)
    Domains in SCOPe 2.07: d5a7oa_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75164
      • conflict (375)
    Domains in SCOPe 2.07: d5a7ob_
  • Heterogens: SO4, 7WH, EDO, ZN, MN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a7oA (A:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaefekesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7oA (A:)
    esetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddid
    dlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywk
    nltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkt
    sfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmt
    lisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqa
    vlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a7oB (B:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaefekesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7oB (B:)
    lnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvi
    papiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltf
    nppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfaw
    htedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisp
    lmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcs
    crkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefe