PDB entry 5a7c

View 5a7c on RCSB PDB site
Description: Crystal structure of the second bromodomain of human BRD3 in complex with compound
Class: DNA binding protein
Keywords: DNA binding protein, brd3, bromodomain containing protein 3, ring3-like protein, brd3 domain 2
Deposited on 2015-07-03, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15059 (2-112)
      • expression tag (1)
    Domains in SCOPe 2.07: d5a7ca1, d5a7ca2
  • Chain 'B':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a7cb_
  • Chain 'C':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a7cc_
  • Chain 'D':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a7cd_
  • Heterogens: 5D4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a7cA (A:)
    smgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkr
    kmdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7cA (A:)
    mgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrk
    mdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a7cB (B:)
    smgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkr
    kmdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7cB (B:)
    gklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkm
    dgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5a7cC (C:)
    smgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkr
    kmdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7cC (C:)
    lsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkmdg
    reypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a7cD (D:)
    smgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkr
    kmdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a7cD (D:)
    lsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkmdg
    reypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp