PDB entry 5a6z

View 5a6z on RCSB PDB site
Description: Structure of the LecB lectin from Pseudomonas aeruginosa strain PA14 in complex with lewis a
Class: sugar binding protein
Keywords: sugar binding protein, lectin, lecb, lewis antigen
Deposited on 2015-07-02, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lecb
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6za_
  • Chain 'B':
    Compound: lecb
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6zb_
  • Chain 'C':
    Compound: lecb
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6zc_
  • Chain 'D':
    Compound: lecb
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6zd_
  • Heterogens: CA, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6zA (A:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6zB (B:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6zC (C:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6zD (D:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg