PDB entry 5a6y

View 5a6y on RCSB PDB site
Description: Structure of the LecB lectin from Pseudomonas aeruginosa strain PA14 in complex with mannose-alpha1,3mannoside
Class: hydrolase
Keywords: hydrolase, lectin, lecb
Deposited on 2015-07-02, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6ya_
  • Chain 'B':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6yb_
  • Chain 'C':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6yc_
  • Chain 'D':
    Compound: Fucose-binding lectin PA-IIL
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a6yd_
  • Heterogens: CA, MAN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6yA (A:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6yB (B:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6yC (C:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6yD (D:)
    atqgvftlpantqfgvtafansagtqtvnvqvnnetvatftgqstnnaiigskvlnsggg
    gkvqilvsvngrssdlvsaqvilanelnfalvgsedstdndyndavvvinwplg