PDB entry 5a6t

View 5a6t on RCSB PDB site
Description: 1.65 A resolution Sulfite inhibited Sporosarcina pasteurii urease
Class: hydrolase
Keywords: hydrolase, urease, nickel, metalloenzyme, sulfite
Deposited on 2015-07-01, released 2015-12-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41022 (0-99)
      • conflict (19)
      • conflict (21)
    Domains in SCOPe 2.05: d5a6ta_
  • Chain 'B':
    Compound: urease subunit beta
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5a6tb_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • conflict (18)
      • conflict (27)
      • insertion (28)
      • conflict (35-37)
      • conflict (41)
      • conflict (262)
      • conflict (402)
      • conflict (419)
  • Heterogens: EDO, SO4, NI, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a6tA (A:)
    mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a6tB (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a6tB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    No sequence available.