PDB entry 5a64

View 5a64 on RCSB PDB site
Description: Crystal structure of mouse thiamine triphosphatase in complex with thiamine triphosphate.
Class: hydrolase
Keywords: hydrolase, triphosphate tunnel metalloenzyme, thiamine triphosphatase
Deposited on 2015-06-24, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a64a_
  • Chain 'B':
    Compound: Thiamine triphosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a64b_
  • Heterogens: V4E, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a64A (A:)
    gmaqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqreg
    sgwelkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqeva
    sfittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvs
    smlgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsass
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a64A (A:)
    glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
    lkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfit
    trsswklaqltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapa
    klmvylqrfrpldyqrlleaass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a64B (B:)
    gmaqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqreg
    sgwelkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqeva
    sfittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvs
    smlgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsass
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a64B (B:)
    glieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsgwe
    lkcphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasfittrsswkla
    qltidldsadfgyavgeveamvhekaevpaalekiitvssmlgvpaqeeapaklmvylqr
    frpldyqrllea