PDB entry 5a5s

View 5a5s on RCSB PDB site
Description: NN-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH 5-5-methoxypyridin-3-yl-3- methyl-8-piperidin-4-ylamino-1,2-dihydro-1,7-naphthyridin-2-one
Class: hydrolase
Keywords: hydrolase, inhibitor, histone, epigenetic reader, bromodomain, brd4, bromodomain containing protein 4, antagonist
Deposited on 2015-06-20, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60885 (2-126)
    • expression tag (0-1)
    • conflict (36)
  Domains in SCOPe 2.07: d5a5sa1, d5a5sa2
• Heterogens: EDO, NP8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5a5sA (A:)
  smnppppetsnpnkpkrqtnqlqyllrvvlktlwkhkfawpfqqpvdavklnlpdyykii
  ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
  nelptee