PDB entry 5a5p

View 5a5p on RCSB PDB site
Description: Crystal structure of human ATAD2 bromodomain in complex with 8-2-(dimethylamino)ethylamino-3-methyl-1,2-dihydroquinolin-2-one
Class: hydrolase
Keywords: hydrolase, inhibitor, atad2, bromodomain, epigenetics, ATPase family aaa domain-containing protein 2
Deposited on 2015-06-20, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATPase family AAA domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PL18 (2-129)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d5a5pa1, d5a5pa2
• Heterogens: EDO, JTF, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5a5pA (A:)
  smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
  dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
  qlceeiqesr