PDB entry 5a5n

View 5a5n on RCSB PDB site
Description: Crystal structure of human ATAD2 bromodomain in complex with (2S)-2,6- diacetamido-N-methylhexanamide
Class: hydrolase
Keywords: hydrolase, inhibitor, epigenetics, ATPase family aaa domain-containing protein 2
Deposited on 2015-06-20, released 2015-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATPase family AAA domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14CR1 (2-129)
    • expression tag (0-1)
  Domains in SCOPe 2.05: d5a5na_
• Heterogens: EDO, 8WS, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5a5nA (A:)
  smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
  dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
  qlceeiqesr