PDB entry 5a5k

View 5a5k on RCSB PDB site
Description: AtGSTF2 from Arabidopsis thaliana in complex with camalexin
Class: transferase
Keywords: transferase, glutathione-s-transferase, gst, plant, arabidopsis
Deposited on 2015-06-18, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ka1, d5a5ka2
  • Chain 'B':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kb1, d5a5kb2
  • Chain 'C':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kc1, d5a5kc2
  • Chain 'D':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kd1, d5a5kd2
  • Chain 'E':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ke1, d5a5ke2
  • Chain 'F':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kf1, d5a5kf2
  • Chain 'G':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kg1, d5a5kg2
  • Chain 'H':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kh1, d5a5kh2
  • Chain 'I':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ki1, d5a5ki2
  • Chain 'J':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kj1, d5a5kj2
  • Chain 'K':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kk1, d5a5kk2
  • Chain 'L':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kl1, d5a5kl2
  • Chain 'M':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5km1, d5a5km2
  • Chain 'N':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kn1, d5a5kn2
  • Chain 'O':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ko1, d5a5ko2
  • Chain 'P':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kp1, d5a5kp2
  • Chain 'Q':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kq1, d5a5kq2
  • Chain 'R':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kr1, d5a5kr2
  • Chain 'S':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ks1, d5a5ks2
  • Chain 'T':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kt1, d5a5kt2
  • Chain 'U':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ku1, d5a5ku2
  • Chain 'V':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kv1, d5a5kv2
  • Chain 'W':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kw1, d5a5kw2
  • Chain 'X':
    Compound: glutathione s-transferase f2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5kx1, d5a5kx2
  • Heterogens: 7WB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a5kA (A:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kA (A:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a5kB (B:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kB (B:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5a5kC (C:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kC (C:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a5kD (D:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kD (D:)
    gikvfghpasiatrrvlialheknldfelvhvekdgehkkepflsrnpfgqvpafedgdl
    klfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeqi
    fksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllgt
    ptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5a5kE (E:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kE (E:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5a5kF (F:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kF (F:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5a5kG (G:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kG (G:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5a5kH (H:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kH (H:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5a5kI (I:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kI (I:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5a5kJ (J:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kJ (J:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5a5kK (K:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kK (K:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5a5kL (L:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kL (L:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5a5kM (M:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kM (M:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5a5kN (N:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kN (N:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllgtptkkl
    fterprvnewvaeitkrpasekvq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5a5kO (O:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kO (O:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryetnllqtdsknisqyaimaigmqvedhqfdpvasklafeqifk
    siydeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllgtptkklf
    terprvnewvaeitkrpasekvq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5a5kP (P:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kP (P:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5a5kQ (Q:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kQ (Q:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5a5kR (R:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kR (R:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5a5kS (S:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kS (S:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5a5kT (T:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kT (T:)
    gikvfghpasiatrrvlialheknldfelvhelkdgehkkepflsrnpfgqvpafedgdl
    klfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeqi
    fksiylttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllgtp
    tkklferprvnewvaeitkrpasekv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5a5kU (U:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kU (U:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5a5kV (V:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kV (V:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5a5kW (W:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kW (W:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5a5kX (X:)
    magikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafed
    gdlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklaf
    eqifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyl
    lgtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5kX (X:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq