PDB entry 5a5e

View 5a5e on RCSB PDB site
Description: crystal structure of murd ligase from escherichia coli
Class: ligase
Keywords: ligase, peptidoglycan synthesis, ADP-forming enzyme, cell wall, cell shape, cell cycle, nucleotide-binding, ATP- binding, cell division, ligand, conformation
Deposited on 2015-06-17, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a5ea1, d5a5ea2, d5a5ea3
  • Heterogens: MPD, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a5eA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a5eA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    ypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhlnhqqget
    wlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfevv
    lehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnvrl
    ycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeqrg
    nefarlakelg