PDB entry 5a5d

View 5a5d on RCSB PDB site
Description: A complex of the synthetic siderophore analogue Fe(III)-5-LICAM with the CeuE periplasmic protein from Campylobacter jejuni
Class: transport protein
Keywords: transport protein, synthetic siderophore, ligand complex, periplasmic binding protein, tetradentate siderophores
Deposited on 2015-06-17, released 2016-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterochelin uptake periplasmic binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P8Q4 (2-288)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5a5da1, d5a5da2
  • Heterogens: FE, 5LC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a5dA (A:)
    amlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknl
    pkylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnan
    flssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafg
    pqsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqg
    ildnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk