PDB entry 5a43

View 5a43 on RCSB PDB site
Description: Crystal structure of a dual topology fluoride ion channel.
Class: transport protein
Keywords: transport protein, fluoride ion channel, fluc, ec2
Deposited on 2015-06-04, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative fluoride ion transporter crcb
    Species: ESCHERICHIA COLI S88 [TaxId:585035]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative fluoride ion transporter crcb
    Species: ESCHERICHIA COLI S88 [TaxId:585035]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: monobodies
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A43 (0-95)
    Domains in SCOPe 2.07: d5a43c_
  • Chain 'D':
    Compound: monobodies
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A43 (0-95)
    Domains in SCOPe 2.07: d5a43d_
  • Heterogens: F, DMU, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5a43C (C:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5a43D (D:)
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt