PDB entry 5a3i

View 5a3i on RCSB PDB site
Description: Crystal Structure of a Complex formed between FLD194 Fab and Transmissible Mutant H5 Haemagglutinin
Class: viral protein
Keywords: viral protein, haemagglutinin, neutralizing antibody, bird flu, h5n1, influenza virus, glycoprotein
Deposited on 2015-06-01, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/VIETNAM/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5A5M5 (2-End)
      • expression tag (0-1)
      • conflict (155)
      • conflict (221)
      • conflict (223)
      • conflict (316)
    Domains in SCOPe 2.07: d5a3ia1, d5a3ia2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/VIETNAM/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a3ib_
  • Chain 'C':
    Compound: anti-haemagglutinin ha1 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A3I (0-End)
  • Chain 'D':
    Compound: anti-haemagglutinin ha1 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A3I (0-End)
    Domains in SCOPe 2.07: d5a3id1, d5a3id2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/VIETNAM/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5A5M5 (2-End)
      • expression tag (0-1)
      • conflict (155)
      • conflict (221)
      • conflict (223)
      • conflict (316)
    Domains in SCOPe 2.07: d5a3ie1, d5a3ie2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: INFLUENZA A VIRUS (A/VIETNAM/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5A5M5 (0-165)
      • conflict (67)
    Domains in SCOPe 2.07: d5a3if_
  • Chain 'G':
    Compound: anti-haemagglutinin ha1 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A3I (0-End)
  • Chain 'H':
    Compound: anti-haemagglutinin ha1 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5A3I (0-End)
    Domains in SCOPe 2.07: d5a3ih1, d5a3ih2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a3iA (A:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a3iA (A:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a3iB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5a3iD (D:)
    divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a3iD (D:)
    divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5a3iE (E:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnspqretr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a3iE (E:)
    dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
    gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
    ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
    hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
    infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
    igecpkyvksnrlvlaiglrnsp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5a3iF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5a3iH (H:)
    divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a3iH (H:)
    divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge