PDB entry 5a25

View 5a25 on RCSB PDB site
Description: Rational engineering of a mesophilic carbonic anhydrase to an extreme halotolerant biocatalyst
Class: lyase
Keywords: lyase, protein engineering, biocatalysis
Deposited on 2015-05-12, released 2015-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a25a_
  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5a25b_
  • Heterogens: ZN, GOL, NA, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a25A (A:)
    mshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmv
    nnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhl
    vhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdp
    gsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellm
    lanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a25A (A:)
    hhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnn
    ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
    wntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
    llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmla
    nwrpaqplknrqvrgfpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5a25B (B:)
    mshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmv
    nnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhl
    vhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdp
    gsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellm
    lanwrpaqplknrqvrgfpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a25B (B:)
    hhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnn
    ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
    wntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
    llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmla
    nwrpaqplknrqvrgfpk