PDB entry 5a1j

View 5a1j on RCSB PDB site
Description: Periplasmic Binding Protein CeuE in complex with ferric 4-LICAM
Class: metal binding protein
Keywords: metal binding protein, metal-binding protein, enterobactin uptake, iron, siderophore, binding protein, tetradentate
Deposited on 2015-04-30, released 2015-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterochelin uptake periplasmic binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P8Q4 (1-287)
      • expression tag (0)
    Domains in SCOPe 2.08: d5a1ja1, d5a1ja2
  • Heterogens: FE, LCM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5a1jA (A:)
mlpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlp
kylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanf
lssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgp
qsrfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgi
ldnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk