PDB entry 5a00

View 5a00 on RCSB PDB site
Description: Structure of human PARP1 catalytic domain bound to an isoindolinone inhibitor
Class: transferase
Keywords: transferase, human parp1, artd1
Deposited on 2015-04-15, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a00a1, d5a00a2
  • Heterogens: D7N, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5a00A (A:)
    gpltvnpgtksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysi
    lsevqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldie
    vaysllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydle
    vidifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfg
    kgiyfadmvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglg
    kttpdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkts
    lw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a00A (A:)
    ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
    qgssdsqildlsnrfytliphdppllnnadsvqakvemldnlldievaysllrggskdpi
    dvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykp
    fkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanycht
    sqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvp
    lgtgissgvndtsllyneyivydiaqvnlkyllklkfnfk