PDB entry 521p

View 521p on RCSB PDB site
Description: three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Class: oncogene protein
Keywords: oncogene protein
Deposited on 1991-06-06, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-ras p21 protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • conflict (11)
      • conflict (58)
    Domains in SCOP 1.75: d521pa_
  • Heterogens: MG, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >521pA (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildttg
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh