PDB entry 4zzz

View 4zzz on RCSB PDB site
Description: Structure of human PARP1 catalytic domain bound to an isoindolinone inhibitor
Class: transferase
Keywords: transferase, human parp1, artd1,
Deposited on 2015-04-15, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zzzb1, d4zzzb2
  • Heterogens: SO4, GOL, FSU, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zzzB (B:)
    gpltvnpgtksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysi
    lsevqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldie
    vaysllrggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydle
    vidifkieregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfg
    kgiyfadmvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglg
    kttpdpsanisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkts
    lw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zzzB (B:)
    klpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsqg
    ssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrggdp
    idvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqryk
    pfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanych
    tsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdv
    plgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt