PDB entry 4zz4

View 4zz4 on RCSB PDB site
Description: Neutron crystal structure of ribonuclease A determined by the real space D/H contrast method
Class: hydrolase
Keywords: Ribonuclease A, D/H contrast, HYDROLASE
Deposited on 2015-05-22, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: NEUT
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.07: d4zz4a_
• Heterogens: IPA, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4zz4A (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv