PDB entry 4zz2

View 4zz2 on RCSB PDB site
Description: human gar transformylase in complex with gar and (s)-2-({5-[3-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)-propyl]-thiophene-3-carbonyl}-amino)-pentanedioic acid
Class: transferase/transferase inhibitor
Keywords: gar transformylase, antifolate, TRANSFERASE-TRANSFERASE INHIBITOR complex, Structural Genomics
Deposited on 2015-05-22, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trifunctional purine biosynthetic protein adenosine-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GART, PGFT, PRGS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zz2a_
  • Heterogens: GAR, 3YG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zz2A (A:)
    marvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
    lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
    aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
    alqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zz2A (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv