PDB entry 4zys

View 4zys on RCSB PDB site
Description: Crystal structure of an exotoxin 6 (SAV0422) from Staphylococcus aureus subsp. aureus Mu50 at 2.25 A resolution
Class: sugar binding protein
Keywords: exotoxin, superantigen-like protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SUGAR BINDING PROTEIN
Deposited on 2015-05-22, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin 6
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: set6, NP_370946.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zysa1, d4zysa2
  • Chain 'B':
    Compound: exotoxin 6
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: set6, NP_370946.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zysb1, d4zysb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zysA (A:)
    gktevkqqseselkhyynkpvlerknvtgykytekgkdyidvivdnqysqislvgsdkdk
    fkdgdnsnidvfilregdsrqatnysiggvtktnsqpfidyihtpileikkgkeepqssl
    yqiykedislkeldyrlreraikqhglysnglkqgqititmkdgkshtidlsqklekerm
    gdsidgrqiqkilvemk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zysA (A:)
    tevkqqseselkhyynkpvlerknvtgykytekgkdyidvivdnqysqislvgsdkdkfk
    dgdnsnidvfilregdsrqatnysiggvtktnsqpfidyihtpileikkgkeepqsslyq
    iykedislkeldyrlreraikqhglysnglkqgqititmkdgkshtidlsqklekermgd
    sidgrqiqkilvemk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zysB (B:)
    gktevkqqseselkhyynkpvlerknvtgykytekgkdyidvivdnqysqislvgsdkdk
    fkdgdnsnidvfilregdsrqatnysiggvtktnsqpfidyihtpileikkgkeepqssl
    yqiykedislkeldyrlreraikqhglysnglkqgqititmkdgkshtidlsqklekerm
    gdsidgrqiqkilvemk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zysB (B:)
    qqseselkhyynkpvlerknvtgykytekgkdyidvivdnqysqislvgsdkdkfkdgdn
    snidvfilregdsrqatnysiggvtktnsqpfidyihtpileikkgkeepqsslyqiyke
    dislkeldyrlreraikqhglysnglkqgqititmkdgkshtidlsqklekermgdsidg
    rqiqkilvemk