PDB entry 4zyi
View 4zyi on RCSB PDB site
Description: Discovery of NVP-CGM097 - a highly potent and selective MDM2 inhibitor undergoing phase 1 clinical trials in p53wt tumors: Hdm2 (MDM2) complexed with cpd2
Class: cell cycle
Keywords: PPI WITH P53, INHIBITOR COMPLEX, cell cycle
Deposited on
2015-05-21, released
2015-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-09-09, with a file datestamp of
2015-09-04.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase Mdm2
Species: Homo sapiens [TaxId:9606]
Gene: MDM2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4zyia_ - Heterogens: 4TH, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4zyiA (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Sequence, based on observed residues (ATOM records): (download)
>4zyiA (A:)
paseqetlvrpkplllkllksvgqkdtytmkevlfylgqyimtkrlydekqqhivycsnd
llgdlfgvpsfsvkehrkiytmiyrnlvvv