PDB entry 4zyi

View 4zyi on RCSB PDB site
Description: Discovery of NVP-CGM097 - a highly potent and selective MDM2 inhibitor undergoing phase 1 clinical trials in p53wt tumors: Hdm2 (MDM2) complexed with cpd2
Class: cell cycle
Keywords: PPI WITH P53, INHIBITOR COMPLEX, cell cycle
Deposited on 2015-05-21, released 2015-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zyia_
  • Heterogens: 4TH, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zyiA (A:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zyiA (A:)
    paseqetlvrpkplllkllksvgqkdtytmkevlfylgqyimtkrlydekqqhivycsnd
    llgdlfgvpsfsvkehrkiytmiyrnlvvv