PDB entry 4zyc

View 4zyc on RCSB PDB site
Description: Discovery of dihydroisoquinolinone derivatives as novel inhibitors of the p53-MDM2 interaction with a distinct binding mode: Hdm2 (MDM2) complexed with cpd5
Class: ligase
Keywords: PPI WITH P53, INHIBITOR COMPLEX, ligase
Deposited on 2015-05-21, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4zyca_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (Start-95)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4zycb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987
      • engineered mutation (17)
    Domains in SCOPe 2.07: d4zycc_
  • Heterogens: 4SS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zycA (A:)
    gsqipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zycA (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zycB (B:)
    gsqipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zycB (B:)
    tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
    fgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zycC (C:)
    gsqipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zycC (C:)
    tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
    fgvpsfsvkehrkiytmiyrnlvvv