PDB entry 4zxm

View 4zxm on RCSB PDB site
Description: Crystal structure of PGRP domain from Branchiostoma belcheri tsingtauense peptidoglycan recognition protein 3
Class: hydrolase
Keywords: peptidoglycan recognition protein, amidase, HYDROLASE
Deposited on 2015-05-20, released 2015-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PGRP domain of peptidoglycan recognition protein 3
    Species: Branchiostoma belcheri tsingtauense [TaxId:155462]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZXM
    Domains in SCOPe 2.08: d4zxma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zxmA (A:)
    mksshhhhhhenlyfqsnaqrwrsdgrcgpnypapdanpgecnphavdhccsewgwcgre
    tshctcsscvdysagggssggstvvvsssgtcprivsksewgsratnynvflslpvpkvv
    ihhsagatcstqsscslqvrniqnyhmdgrgysdigynflvgndgnvyegrgwdrrgaha
    lnvntesigicfmgdftsqkptasaiaaaksliscgvslgkirsgyslyghrdvgstacp
    gnllyddikswgryvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxmA (A:)
    tcprivsksewgsratnynvflslpvpkvvihhsagatcstqsscslqvrniqnyhmdgr
    gysdigynflvgndgnvyegrgwdrrgahalnvntesigicfmgdftsqkptasaiaaak
    sliscgvslgkirsgyslyghrdvgstacpgnllyddikswgryv