PDB entry 4zxg

View 4zxg on RCSB PDB site
Description: Ligandin binding site of PfGST
Class: transferase
Keywords: GST, Plasmodium falciparum, Hemin, transferase
Deposited on 2015-05-20, released 2015-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: GST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zxga1, d4zxga2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: GST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zxgb1, d4zxgb2
  • Heterogens: SO4, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zxgA (A:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
    qigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnett
    flnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslkn
    fpllkahnefisnlpniknyitnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxgA (A:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
    qigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnett
    flnedlpkwsgyfekllkknhtnnnkyyfvgnnltyadlavfnlyddietkypslknfpl
    lkahnefisnlpniknyitnrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zxgB (B:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
    qigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnett
    flnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslkn
    fpllkahnefisnlpniknyitnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zxgB (B:)
    dnivlyyfdargkaelirlifaylgieytdkrfgvdafvefknfkkekdtpfeqvpilqi
    gdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnettfl
    nedlpkwsgyfekllkkndkyyfvgnnltyadlavfnlyddietkylknfpllkahnefi
    snlpniknyitnrk