PDB entry 4zwv

View 4zwv on RCSB PDB site
Description: Crystal Structure of Aminotransferase AtmS13 from Actinomadura melliaura
Class: transferase
Keywords: aminotransferase, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2015-05-19, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (3-371)
      • expression tag (2)
    Domains in SCOPe 2.07: d4zwva1, d4zwva2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Actinomadura melliaura [TaxId:360723]
    Gene: atS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0H2X1 (3-371)
      • expression tag (2)
    Domains in SCOPe 2.07: d4zwvb1, d4zwvb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zwvA (A:)
    snamiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsg
    lclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkis
    patraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgn
    mcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwh
    mtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkv
    ddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqd
    rehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwvA (A:)
    amiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglc
    lalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispa
    traiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmc
    vfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmt
    dlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvdd
    rpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdre
    hvvatirsgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zwvB (B:)
    snamiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsg
    lclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkis
    patraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgn
    mcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwh
    mtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkv
    ddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqd
    rehvvatirsgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwvB (B:)
    amiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglc
    lalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispa
    traiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmc
    vfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmt
    dlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvdd
    rpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdre
    hvvatirsgw