PDB entry 4zwm

View 4zwm on RCSB PDB site
Description: 2.3 A resolution crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49
Class: transferase
Keywords: Structural Genomics, pyridoxal 5'-phosphate (PLP)-independent aminotransferase, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-05-19, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine aminotransferase, mitochondrial, putative
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zwma_
  • Chain 'B':
    Compound: Ornithine aminotransferase, mitochondrial, putative
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zwmb_
  • Heterogens: PLP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zwmA (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwmA (A:)
    rktnieayrdglklkteedffacdrqyvcqnyavpvviskgkgarvwdingneyydflag
    vsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgae
    agesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgf
    elidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivde
    iqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfg
    gnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnave
    vdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveee
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zwmB (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zwmB (B:)
    arktnieayrdglklkteedffacdrqyvcqnyavpvviskgkgarvwdingneyydfla
    gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
    eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
    felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
    eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
    ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
    evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
    erk