PDB entry 4zu5

View 4zu5 on RCSB PDB site
Description: Crystal structure of the QdtA 3,4-Ketoisomerase from Thermoanaerobacterium thermosaccharolyticum, apo form
Class: isomerase
Keywords: cupin, isomerase, 3, 4-ketoisomerase
Deposited on 2015-05-15, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: QdtA
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Gene: qdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TFC5 (0-135)
      • see remark 999 (51)
      • see remark 999 (93-94)
      • see remark 999 (115)
      • expression tag (136-137)
    Domains in SCOPe 2.07: d4zu5a1, d4zu5a2
  • Chain 'B':
    Compound: QdtA
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Gene: qdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TFC5 (Start-135)
      • see remark 999 (51)
      • see remark 999 (93-94)
      • see remark 999 (115)
      • expression tag (136)
    Domains in SCOPe 2.07: d4zu5b1, d4zu5b2
  • Heterogens: THM, PXN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zu5A (A:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zu5A (A:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrfle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zu5B (B:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zu5B (B:)
    lynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvli
    clngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetdy
    irnydfyideakkrfl