PDB entry 4zth

View 4zth on RCSB PDB site
Description: Structure of human p38aMAPK-arylpyridazinylpyridine fragment complex used in inhibitor discovery
Class: transferase
Keywords: Transferase
Deposited on 2015-05-14, released 2016-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ztha_
  • Heterogens: VVT, GG5, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zthA (A:)
    mhhhhhhssgvdlgtenlyfqsnasqerptfyrqelnktiwevperyqnlspvgsgaygs
    vcaafdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsle
    efndvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnla
    vnedcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaell
    tgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiga
    nplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidew
    ksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zthA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglvatrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvpppl