PDB entry 4zt1

View 4zt1 on RCSB PDB site
Description: Crystal structure of human E-Cadherin (residues 3-213) in x-dimer conformation
Class: cell adhesion
Keywords: adhesion, cadherin, calcium-binding protein, x-dimer., CELL ADHESION
Deposited on 2015-05-14, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zt1a1, d4zt1a2
  • Chain 'B':
    Compound: Cadherin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CDH1, CDHE, UVO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zt1b1, d4zt1b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zt1A (A:)
    vippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkv
    tepldreriatytlfshavssngnavedpmeilitvtdqndnkpeftqevfkgsvmegal
    pgtsvmevtatdadddvntynaaiaytilsqdpelpdknmftinrntgvisvvttgldre
    sfptytlvvqaadlqgeglsttatavitvtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zt1A (A:)
    ppiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvte
    pldreriatytlfshavssngnavedpmeilitvtdqndnkpeftqevfkgsvmegalpg
    tsvmevtatdadddvntynaaiaytilsqdpelpdknmftinrntgvisvvttgldresf
    ptytlvvqaadlqgeglsttatavitvtd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zt1B (B:)
    vippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkv
    tepldreriatytlfshavssngnavedpmeilitvtdqndnkpeftqevfkgsvmegal
    pgtsvmevtatdadddvntynaaiaytilsqdpelpdknmftinrntgvisvvttgldre
    sfptytlvvqaadlqgeglsttatavitvtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zt1B (B:)
    ppiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvte
    pldreriatytlfshavssngnavedpmeilitvtdqndnkpeftqevfkgsvmegalpg
    tsvmevtatdadddvntynaaiaytilsqdpelpdknmftinrntgvisvvttgldresf
    ptytlvvqaadlqgeglsttatavitvtd