PDB entry 4zse

View 4zse on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M/V948R, crystal form II
Class: transferase
Keywords: egfr, t790m, v948r, transferase
Deposited on 2015-05-13, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d4zsea_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (Start-330)
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d4zseb_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d4zsec_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d4zsed_
  • Heterogens: ANP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zseA (A:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zseA (A:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkanke
    ildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkc
    wmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zseB (B:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zseB (B:)
    apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank
    eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhr
    iythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrk
    cwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmdd
    vvdadeylipqqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zseC (C:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zseC (C:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvd
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zseD (D:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zseD (D:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrespkankeilde
    ayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqia
    kgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgvpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeevvdade