PDB entry 4zs7

View 4zs7 on RCSB PDB site
Description: Structural mimicry of receptor interaction by antagonistic IL-6 antibodies
Class: immune system
Keywords: Interleukine 6 Complex, Fab fragment, Dromedery, immune system
Deposited on 2015-05-13, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6, IFNB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zs7a_
  • Chain 'H':
    Compound: Llama Fab fragment 68F2 heavy chain
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZS7 (0-221)
  • Chain 'L':
    Compound: Llama Fab fragment 68F2 light chain
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZS7
    Domains in SCOPe 2.06: d4zs7l1, d4zs7l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zs7A (A:)
    phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc
    fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl
    daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zs7A (A:)
    eridkqiryildgisalrketcnksnnlpkmaekdgcfqsgfneetclvkiitgllefev
    yleylqnrfesseeqaravqmstkvliqflqkkaknlddpttnaslltklqwlqdmtthl
    ilrsfkeflqsslralrqm
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4zs7L (L:)
    qavltqpplvsgtpgqtvtiscaganndigtyayvswyqqlpgtapklliykvttrasgi
    psrfsgsksgntasltisglqsedeadyycasyrnfnnavfgrgthltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zs7L (L:)
    vltqpplvsgtpgqtvtiscaganndigtyayvswyqqlpgtapklliykvttrasgips
    rfsgsksgntasltisglqsedeadyycasyrnfnnavfgrgthltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap