PDB entry 4zrw

View 4zrw on RCSB PDB site
Description: Structure of cow mincle complexed with trehalose
Class: sugar binding protein
Keywords: glycobiology, carbohydrate-binding protein, C-type lectin, complex, SUGAR BINDING PROTEIN
Deposited on 2015-05-12, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mincle protein
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-145)
      • expression tag (0)
      • variant (111)
      • expression tag (146-147)
    Domains in SCOPe 2.08: d4zrwa1, d4zrwa2, d4zrwa3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4zrwA (A:)
aelscyndgsgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqee
qeflyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatir
dssnprqnwndvpcffnmfrvcemperki

    Sequence, based on observed residues (ATOM records): (download) 
    >4zrwA (A:)
aelscyndgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqe
flyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirds
snprqnwndvpcffnmfrvcemperk