PDB entry 4zrv

View 4zrv on RCSB PDB site
Description: Structure of cow mincle CRD complexed with trehalose mono butyrate
Class: sugar binding protein
Keywords: glycobiology, carbohydrate-binding protein, C-type lectin, complex, SUGAR BINDING PROTEIN
Deposited on 2015-05-12, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mincle CRD
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • see remark 999 (0)
      • variant (96)
      • see remark 999 (131)
    Domains in SCOPe 2.07: d4zrva1, d4zrva2
  • Chain 'B':
    Compound: Mincle CRD
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • see remark 999 (0)
      • variant (96)
    Domains in SCOPe 2.07: d4zrvb1, d4zrvb2
  • Chain 'C':
    Compound: Mincle CRD
    Species: Bos taurus [TaxId:9913]
    Gene: CLEC4E
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BHM0 (1-130)
      • see remark 999 (0)
      • variant (96)
    Domains in SCOPe 2.07: d4zrvc1, d4zrvc2
  • Heterogens: 4RS, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zrvA (A:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrvA (A:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemper
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zrvB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrvB (B:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcempe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zrvC (C:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcemperki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrvC (C:)
    acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
    igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
    fnmfrvcempe