PDB entry 4zri

View 4zri on RCSB PDB site
Description: Crystal structure of Merlin-FERM and Lats2
Class: signaling protein/transferase
Keywords: Merlin, FERM, Lats2
Deposited on 2015-05-12, released 2015-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zria1, d4zria2, d4zria3
  • Chain 'B':
    Compound: merlin
    Species: Homo sapiens [TaxId:9606]
    Gene: NF2, SCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrib1, d4zrib2, d4zrib3
  • Chain 'C':
    Compound: Serine/threonine-protein kinase LATS2
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS2, KPM
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Serine/threonine-protein kinase LATS2
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS2, KPM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zriA (A:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zriA (A:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasv
    llasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgra
    rdeaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwn
    eirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zriB (B:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyfairnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zriB (B:)
    tftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkk
    vldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekiycppeasvl
    lasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgrar
    deaemeylkiaqdlemygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwne
    irnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.