PDB entry 4zra

View 4zra on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis lprg binding to triacylglyceride
Class: lipid binding protein
Keywords: LprG, lipoprotein, structural genomics, TB STRUCTURAL GENOMICS CONSORTIUM, TBSGC, LIPID BINDING PROTEIN
Deposited on 2015-05-12, released 2016-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lprG, lpp-27, Rv1411c, MTCY21B4.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zraa_
  • Chain 'C':
    Compound: Lipoprotein lprG
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: lprG, lpp-27, Rv1411c, MTCY21B4.28c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WK45 (7-End)
      • expression tag (5-6)
    Domains in SCOPe 2.06: d4zrac1, d4zrac2
  • Heterogens: 4RF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zraA (A:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zraA (A:)
    gplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkltl
    ggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadakae
    grdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgsgn
    svqmtlskwgekvqvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zraC (C:)
    mhhhhhhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaat
    gnvkltlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlan
    fadakaegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaq
    ldrgsgnsvqmtlskwgekvqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zraC (C:)
    hhgplpdakplveeataqtkalksahmvltvngkipglslktlsgdlttnptaatgnvkl
    tlggsdidadfvvfdgilyatltpnqwsdfgpaadiydpaqvlnpdtglanvlanfadak
    aegrdtingqntirisgkvsaqavnqiappfnatqpvpatvwiqetgdhqlaqaqldrgs
    gnsvqmtlskwgek