PDB entry 4zr8

View 4zr8 on RCSB PDB site
Description: Structure of uroporphyrinogen decarboxylase from Acinetobacter baumannii
Class: lyase
Keywords: SSGCID, Acinetobacter baumannii, uroporphyrinogen decarboxylase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LYASE
Deposited on 2015-05-11, released 2015-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrinogen decarboxylase
    Species: Acinetobacter baumannii AB5075 [TaxId:1116234]
    Gene: hemE, A591_A1129
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zr8a_
  • Chain 'B':
    Compound: Uroporphyrinogen decarboxylase
    Species: Acinetobacter baumannii AB5075 [TaxId:1116234]
    Gene: hemE, A591_A1129
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zr8b_
  • Heterogens: MG, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zr8A (A:)
    mahhhhhhmttlkndrflrallrepvdttpiwmmrqagrylpeyretrskagdflslckn
    tefacevtlqplrrydldaailfsdiltipdalglglyfetgegpkfhktvrteqdvanl
    pklnakadldyvmnavstirsalggqvpligfsgspwtlatymveggsskefrftkqmmy
    aqpevlhalldhladsvidylnaqidagaqaiqifdswggalahreyvefslnymkkiia
    glqrekdgrripvivftkgggqwlepmittgadalgldwttplntarttvagrvalqgnl
    dpavlygsaasiekavkamlddayangektgyvanlghgitqwvdpaqpkifvdtvheys
    akylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zr8A (A:)
    tlkndrflrallrepvdttpiwmmrqagrylpeyretrskaglslckntefacevtlqpl
    rrydldaailfsdiltipdalglglyfetgegpkfhktvrteqdvanlpklnakadldyv
    mnavstirsalggqvpligfsgspwtlatymveggsskefrftkqmmyaqpevlhalldh
    ladsvidylnaqidagaqaiqifdswggalahreyvefslnymkkiiaglqrekdgrrip
    vivftkgggqwlepmittgadalgldwttplntarttvagrvalqgnldpavlygsaasi
    ekavkamlddayangektgyvanlghgitqwvdpaqpkifvdtvheysakylg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zr8B (B:)
    mahhhhhhmttlkndrflrallrepvdttpiwmmrqagrylpeyretrskagdflslckn
    tefacevtlqplrrydldaailfsdiltipdalglglyfetgegpkfhktvrteqdvanl
    pklnakadldyvmnavstirsalggqvpligfsgspwtlatymveggsskefrftkqmmy
    aqpevlhalldhladsvidylnaqidagaqaiqifdswggalahreyvefslnymkkiia
    glqrekdgrripvivftkgggqwlepmittgadalgldwttplntarttvagrvalqgnl
    dpavlygsaasiekavkamlddayangektgyvanlghgitqwvdpaqpkifvdtvheys
    akylg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zr8B (B:)
    lkndrflrallrepvdttpiwmmrqagrylpeyretrskagdflslckntefacevtlqp
    lrrydldaailfsdiltipdalglglyfetgegpkfhktvrteqdvanlpklnakadldy
    vmnavstirsalggqvpligfsgspwtlatymveggsskefrftkqmmyaqpevlhalld
    hladsvidylnaqidagaqaiqifdswggalahreyvefslnymkkiiaglqrekdgrri
    pvivftkgggqwlepmittgadalgldwttplntarttvagrvalqgnldpavlygsaas
    iekavkamlddayangektgyvanlghgitqwvdpaqpkifvdtvheysakylg