PDB entry 4zr2
View 4zr2 on RCSB PDB site
Description: Crystal Structure of the Domain-Swapped Dimer K40L:Q108K:Y60W mutant of Human Cellular Retinol Binding Protein II
Class: lipid binding protein
Keywords: Domain Swapped Dimer, Domain Swapping, Protein folding, Human Cellular Retinol Binding Protein II, Intracellular Lipid Binding Protein, Retinal, LIPID BINDING PROTEIN
Deposited on
2015-05-11, released
2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-01, with a file datestamp of
2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Retinol-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: RBP2, CRBP2
Database cross-references and differences (RAF-indexed):
- Uniprot P50120 (0-132)
- engineered mutation (39)
- engineered mutation (59)
- engineered mutation (107)
Domains in SCOPe 2.07: d4zr2a_ - Chain 'B':
Compound: Retinol-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: RBP2, CRBP2
Database cross-references and differences (RAF-indexed):
- Uniprot P50120 (0-132)
- engineered mutation (39)
- engineered mutation (59)
- engineered mutation (107)
Domains in SCOPe 2.07: d4zr2b_ - Heterogens: RET, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4zr2A (A:)
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrnw
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4zr2B (B:)
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrnw
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk