PDB entry 4zqy

View 4zqy on RCSB PDB site
Description: Ringhalexin from hemachatus haemachatus: A novel inhibitor of extrinsic tenase complex
Class: toxin
Keywords: Ringhalexin, three finger toxin, Anticoagulant, TOXIN
Deposited on 2015-05-11, released 2016-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ringhalexin
    Species: Hemachatus haemachatus [TaxId:8626]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZQY (0-64)
    Domains in SCOPe 2.06: d4zqya_
  • Chain 'B':
    Compound: Ringhalexin
    Species: Hemachatus haemachatus [TaxId:8626]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZQY (0-64)
    Domains in SCOPe 2.06: d4zqyb_
  • Chain 'C':
    Compound: Ringhalexin
    Species: Hemachatus haemachatus [TaxId:8626]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ZQY (0-64)
    Domains in SCOPe 2.06: d4zqyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zqyA (A:)
rlclsdysifsetieicpeghnycfkkfpkgitrlpwvirgcaatcpkpeaqvyvdccar
dkcnr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zqyB (B:)
rlclsdysifsetieicpeghnycfkkfpkgitrlpwvirgcaatcpkpeaqvyvdccar
dkcnr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zqyC (C:)
rlclsdysifsetieicpeghnycfkkfpkgitrlpwvirgcaatcpkpeaqvyvdccar
dkcnr