PDB entry 4zqi

View 4zqi on RCSB PDB site
Description: Crystal structure of Apo D-alanine-D-alanine ligase(DDL) from Yersinia pestis
Class: ligase
Keywords: Apo, LIGASE
Deposited on 2015-05-10, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: ddl, ddlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zqia1, d4zqia2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: ddl, ddlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zqib1, d4zqib2
  • Chain 'C':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: ddl, ddlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zqic1, d4zqic2
  • Chain 'D':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: ddl, ddlB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4zqid1, d4zqid2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zqiA (A:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdvlie
    kwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqqlaal
    alqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvar
    ilmlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zqiA (A:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshsvgmskvdhaselqkalveafqhdsdvliekwl
    sgpeftvailgdevlpsiriqppgvktqyfcpsglsdeseqqlaalalqayhaldcsgwg
    rvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvarilmlad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zqiB (B:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdvlie
    kwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqqlaal
    alqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvar
    ilmlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zqiB (B:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshesvgmskvdhaselqkalveafqhdsdvliekw
    lsgpeftvailgdevlpsiriqpptqyfcpsglsdeseqqlaalalqayhaldcsgwgrv
    dvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvarilmlad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4zqiC (C:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdvlie
    kwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqqlaal
    alqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvar
    ilmlad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zqiD (D:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdvlie
    kwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqqlaal
    alqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvar
    ilmlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zqiD (D:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshegvgmskvdhaselqkalveafqhdsdvliekw
    lsgpeftvailgdevlpsiriqppgdktqyfcpsglsdeseqqlaalalqayhaldcsgw
    grvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvarilmlad