PDB entry 4zp3

View 4zp3 on RCSB PDB site
Description: AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of regulatory subunits of PKA
Class: signaling protein
Keywords: anchor points, amphiphathic helix, AKAP, DD-domain, signaling protein
Deposited on 2015-05-07, released 2016-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3a_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3b_
  • Chain 'C':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3c_
  • Chain 'D':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3d_
  • Chain 'E':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3e_
  • Chain 'F':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3f_
  • Chain 'G':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3g_
  • Chain 'H':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3h_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3i_
  • Chain 'J':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3j_
  • Chain 'K':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3k_
  • Chain 'L':
    Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR2A, PKR2, PRKAR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4zp3l_
  • Chain 'M':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: A-kinase anchor protein 7 isoforms alpha and beta
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP7, AKAP15, AKAP18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zp3A (A:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4zp3B (B:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3B (B:)
ippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4zp3C (C:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3C (C:)
ippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4zp3D (D:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3D (D:)
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >4zp3E (E:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3E (E:)
ippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >4zp3F (F:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3F (F:)
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >4zp3G (G:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3G (G:)
hiqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >4zp3H (H:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3H (H:)
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >4zp3I (I:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3I (I:)
ppgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'J':
    Sequence, based on SEQRES records: (download) 
    >4zp3J (J:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3J (J:)
iqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'K':
    Sequence, based on SEQRES records: (download) 
    >4zp3K (K:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

    Sequence, based on observed residues (ATOM records): (download) 
    >4zp3K (K:)
ppgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4zp3L (L:)
shiqippgltellqgytvevlrqqppdlvefaveyftrlrear

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.